Biotinylated BCMA Fc&Avi Tag Protein, Human
SKU: 13699771146

Biotinylated BCMA Fc&Avi Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated BCMA Fc&Avi Tag Protein, HumanProduct Specification Species Human Antigen BCMA Synonyms TNFRSF17, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Met1 Ala54, with C terminal Human IgG1 Fc &Avi tag

Product Specification


Species Human
Antigen BCMA
Synonyms TNFRSF17, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Met1-Ala54, with C-terminal Human IgG1 Fc &Avi tag

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE


Expression System HEK293
Molecular Weight

38-45kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Nina Shah, Ajai Chari, Emma Scott, Khalid Mezzi& Saad Z. Usmani: B-cell maturation antigen (BCMA) in multiple myeloma:rationale for targeting and current therapeutic approaches, Leukemia volume 34, pages985–1005 (2020).


Background

BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13699771146

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 465 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
madison
Bozeman, US
★★★★★ 5
nice quality
Fit Type: Regular Fit, Color: White, Size: Small
nice quality shirt. bought this just so i had at least one nice white button down and it's great. fits well and is a nice white color.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
J
Verified Purchase
Jerry
Dallas, US
★★★★★ 5
A perfect white work shirt.
Fit Type: Regular Fit, Color: White, Size: Medium
Thick, durable, iron exquisitely and the fit is spot on. Perfect white work shirt. I have a grey shirt too, the quality is the same.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 4, 2026
B
Verified Purchase
Blusher
Louisville, US
★★★★★ 3
Right fit
I love this shirt it was nice and bright when I got it after a few wash it started to fade out a bit was a perfect fit for a medium built person 5’7 I still would recommend this product they are really nice and thick
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 14, 2025
L
Verified Purchase
Linda Mokkosian
Boise, US
★★★★★ 5
Excellent value and has saved me from the sun!
Fit Type: Regular Fit, Color: White, Size: Large
I ordered this large mans shirt because it was 100% cotton and long sleeve. I am a woman and use it to protect myself from the sun walking my dog, very stiff at first, but comes out with several washes. I love the shirt!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
W
Verified Purchase
Wilf
Port Orchard, US
★★★★★ 4
NICE Shirt that SHRINKS!!
Fit Type: Regular Fit, Color: Blue, Size: X-Large
Loved this shirt right out of the package. Put a little steam pressing on it and it was perfect. Has a thicker softer feel than most casual dress shirts. Ordered XL with the "regular" fit and it could be worn tucked or out without it looking overly blousy. SADLY, after a first wash on cold and tumble dry low, and pulled it out early and it shrunk by almost a full size!!! The sleeves, length of shirt and overall fittage shrunk so that now it fits like a snug large. I've never had a shirt shrink like this, hence, the one star off. I would have given it 2 stars off, but the original quality of the shirt is nice, just beware of the shrinkage factor. Don't put it in the dryer at all, only air dry it. I'm tempted to reorder another but just then never put it in the dryer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026

recommand products