HBV Surface Antigen-preS2 Protein
SKU: 35661447784

HBV Surface Antigen-preS2 Protein

Sale price$86.40 Regular price$96.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

HBV Surface Antigen-preS2 ProteinProduct Specification Species HBV Synonyms Middle surface antigen; PreS2 Accession P03140 Amino Acid Sequence MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN Expression System E. coli Molecular Weight 5. 8 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 20mM PB, 50mM NaCl, pH7. 4 Reconstitution Reconstitute at less than 1

Product Specification


Species HBV
Synonyms Middle surface antigen; PreS2
Accession P03140
Amino Acid Sequence

MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN

Expression System E.coli
Molecular Weight

5.8 kDa(Reducing)

Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

20mM PB, 50mM NaCl, pH7.4

Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Hepatitis B surface antigen S2 (HBV Surface Antigen-preS2) is the smallest unit of transcriptional activator encoded by the surface gene of hepatitis B virus (HBV). It can be used as an auxiliary diagnostic reagent for hepatitis B virus infection. It exists in more than 1/3 of HBV integration units, and HBV integration units are an important factor in inducing liver cancer (HCC). HBV Surface Antigen-preS2 is also an effective regulator of apoptosis induced by tumor necrosis factor-related apoptosis-inducing ligand (TRAIL). It is involved in promoting hepatocyte apoptosis induced by TRAIL, thereby increasing the risk of malignant transformation of human hepatocellular carcinoma cell line (HepG2).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35661447784

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 2240 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Dr. R
Omaha, US
★★★★★ 4
Good quality cover
Color: White, Size: Queen, Color: White, Size: Queen
First, this pillow cover arrived in a plastic bag (see 4th photo), not a box as the photos online show. Although that does not matter to me, it may matter to other people such as those who intend to give this as a gift. One of the photos I included shows the fabric makeup which is mostly polyester and memory foam with the outer cover having “40% Bamboo Rayon.” It seems like an overstatement to me to market this product as a “quilted bamboo pillow cover” where there’s very little, if any, actual bamboo in it. If you have read up on what “bamboo rayon” actually is, you’ll understand. The material make up aside, the cover is soft and puffier than a cotton pillowcase. Bamboo rayon does have qualities that allow airflow for a cooling type of effect. It washes very nicely. As for the size of the pillar cover, I have tried several pillows inside this case, and the case is at least 2 inches longer than every standard pillow I own (See second photo). Pillowcases with a zipper generally are more fitted in every dimension. This pillow cover fits in all dimensions, except for it is longer than necessary. Not a horrible thing, but worth mentioning. The sewing of this product is good. It has a standard plastic zipper. There’s piping around the entire seam area for touch of class. The gray piping on mine matches the quilting. This is not quilting of the standard sense where threads go through to the other side. It is more of a faux quilting, which you can that on the inside in the photo with the tag. Overall, it seems to be a good product especially for people who sweat when they sleep. Quilted Bamboo Pillow Cover Collection – Cooling Pillow Protector with Zipper – Soft, Breathable & Washable Fabric (White, Queen) $19.99 at the time of this review
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2025
J
Jailyn
Alexandria, US
★★★★★ 5
Very easy and convenient
Color: White, Size: Queen
Absolutely in love with this pillow case. I have a tendency to let the kids on the bed with snacks and it’s helpful to just be able to take the case off and put it in the washer when it’s dirty
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2026
M
Verified Purchase
MJ
Alexandria, US
★★★★★ 5
Nicest Bed Pillow Protectors I have found!
Size: Body
I have ordered these pillow protector cases multiple times for pillows that are extra thick or lofted as these seem to be very comfortable, durable, and really protect the pillow itself! They wash up well if there is any sort of stain. Nice bed pillows can be a real investment…it’s both easier to wash these protectors with my bed linens and more sanitary overall. Thin pillow protectors either wrinkle or fail to actually protect the pillow itself from whatever…dust mites, head lice, sweat, make up, skin care, spit up….be sure to follow the instructions for laundering and drying them and they will last a long time! My experience is these protectors keep my pillows from getting lumpy or bunching up, so promote a better night’s sleep!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
T
Verified Purchase
Tim
Lake Worth, US
★★★★★ 5
This is definitely not your average pillow protector!
You have to see and feel this pillow protector to understand just how good it is (photos and videos just don't do it justice). It looks and feels like some sort of fancy premium luxury pillow case, but it's a zippered pillow protector! I always thought pillow protectors were just a simple white cotton zippered pillow case in order to add another layer in addition to the pillow case, but this pillow protector from COOP Home Goods completely blows me away. I just kept going, "Omg, are you kidding me? This is just a pillow protector?! Wow!" The only negative is, the zippered opening is too small. When I tried to put my brand new COOP pillow into it (I have the pillow that has approximately 15,000 reviews), it was very difficult. This was before I removed any of the filling for customization though, which I still needed to do. I finally got around to doing that and I probably removed about 1/3rd of the filling because I'm mostly a stomach sleeper, so I'm sure the pillow protector will be much easier to put on the next time I remove it, but I'm not going to remove it until I have to wash it because I don't want to be stuck trying to put it back on again! That's how annoying it was to put on. I'm keeping it though because I'm hoping it will mean I'll never have to wash the pillowcase or especially the pillow! That'd be awesome. I recently upgraded from a MyPillow Premium and I hated washing it (it was always a mini project, so I am hoping to be completely done with that). I contacted COOP about the small opening and they said, "We do have plans to change the zipper placement on our pillow protectors, however, production has not started and we do not have a firm date to provide you with at this time." They also reminded me that the pillow can be "bent and manipulated" (their words) into the pillow protector. See next paragraph though to understand why I didn't want to handle the pillow too much, otherwise I would've just done that instinctively. There is one more negative aspect that's worth mentioning, but it's due to a personal issue (there's nothing COOP can do about it). I have rough dry skin on my hands, and the material (40% Bamboo-derived Viscose Rayon, 60% Polyester) is rather 'catchy' on my hands. If you have rough dry skin and if you've ever tried to handle something made out of silk, you know what I'm talking about; you can't enjoy the silky smooth texture. This isn't anywhere near as bad as silk, but it's just bad enough that it's worth mentioning. I think it's due to the Bamboo-derived Viscose Rayon. The pillows are the same way for me due to the pillow case. That's probably what made the pillow case so difficult to put on because I was trying to be very careful not to get my skin flakes all over everything from just "manhandling" it, which is what I should've done and then just vacuumed it clean. heh I won't use lotion though because I don't like the idea of getting lotion on everything I touch every day, and it makes my hands sweat much easier - especially in the summer. So, I prefer to just deal with clean but rough dry hands. I guess another negative thing could be that it's not possible to just buy 1 pillow protector. These are 2-packs. I only needed 1 pillow protector and I only wanted 1. I would've gladly paid $15 for just 1. So anyway, beyond that, these pillow protectors truly have that "wow!" factor. They're exactly as advertised and more (because some things are only possible to know about by experiencing them for yourself).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2018
I
Verified Purchase
Ihave6kids
Draper, US
★★★★★ 5
Best pillow protector ive ever used!
Size: Body
I was afraid this pillow protector would inflate with air like every other pillow protector I've ever used (from super cheap to super not cheap). Man was I wrong! You can't even tell it's on the pillow and it doesn't take away from the squishy goodness of the pillow. I love these body pillow protectors so much I've ordered 5 so I'm never without! I also use their regular sized pillow protectors and it's the same exceptional quality. Coop home Good's outdid themselves with this one and I couldn't be happier. Body pillows are expensive and this is a good way for me to protect my investment without sacrificing any comfort! LOVE IT! UPDATE: I've been using these for a few months now and they're just as soft now as the day I put them on. But I have finally given in to the fact that they're a tad troublesome getting on and off. When I first got them I washed them often and line dried (these take a long time to dry, you have to flip them inside out over and over to get them fully dried because the inside will hold the water from the washing machine). However over time I've found myself washing them less frequently because it takes all day to get them dry but also because I'm always nervous the zipper will break during put ons and take offs. You are supposed to squish your pillow into and out of the opening which obviously is very possible but there's no way to avoid putting stress on the zipper opening during this process. Another thing about these protectors is that the greyish strip along the sides is NOT water proof. So everytime I do take the protectors off i find new stains along the sides where the pillow had no protection. And I could be wrong but I think the non-water proof gusseted sides are an essential to the extreme comfort of these protectors so I can't be too picky (otherwise I believe these would inflate with air anytime pressure is applied). If I didn't have young children I probably would've never even realized the sides aren't waterproof. I would still take the coop Home Good's pillow protector with non water proof gusseted sides over the average pillow protector ANY DAY.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2018

recommand products