Biotinylated CTLA4 Fc&Avi Tag Protein, Human
SKU: 65242557169

Biotinylated CTLA4 Fc&Avi Tag Protein, Human

Sale price$266.40 Regular price$296.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CTLA4 Fc&Avi Tag Protein, HumanProduct Specification Species Human Antigen CTLA4 Synonyms CTLA4,CD152 Accession P16410 Amino Acid Sequence Ala37 Phe162, with C terminal Human IgG1 Fc & Avi tag

Product Specification


Species Human
Antigen CTLA4
Synonyms CTLA4,CD152
Accession P16410
Amino Acid Sequence

Ala37 - Phe162, with C-terminal Human IgG1 Fc & Avi tag

AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE


Expression System HEK293
Molecular Weight

43-55Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Shuang Qin, Linping Xu, Ming Yi, Shengnan Yu,Kongming Wu & Suxia Luo: Novel immune checkpoint targets: moving beyondPD-1 and CTLA-4: MolecularCancer volume 18, Article number: 155 (2019).

Background

Cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) is an inhibitory receptor belonging to the CD28 immunoglobulin subfamily, expressed primarily by T-cells. The family includes CD28, CTLA-4 and ICOS as well as other proteins including PD-1, BTLA and TIGIT.Its ligands, CD80 and CD86, are typically found on the surface of antigen-presenting cells and can either bind CD28 or CTLA-4, resulting in a costimulatory or a co-inhibitory response, respectively. Because of its dampening effect, CTLA-4 is a crucial regulator of T-cell homeostasis and self-tolerance. The mechanisms by which CTLA-4 exerts its inhibitory function can be categorized as either cell-intrinsic (affects the CTLA-4 expressing T-cell) or cell-extrinsic (affects secondary cells). CTLA-4 mainly acts in a cell-extrinsic manner via its competition with CD28, CTLA-4-mediated trans-endocytosis of CD80 and CD86, and its direct tolerogenic effects on the interacting cell.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65242557169

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 163 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
juliesaykosy
Houston, US
★★★★★ 5
Busy bee 🐝
Style: Bees, Style: Bees
Such a cute toy that my dog loves ! Yellow is her favorite and when she saw this she instantly gleamed with joy! I love that the dogs can also dig to find the bees which for a dachshund owner helped keeping her a busy bee
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
E
Verified Purchase
Em
Lexington, US
★★★★★ 5
Our Pup's New Favorite!
Style: Rabbit
This is my 2 year old Golden Retriever's new favorite toy! She was confused, at first, with why the carrot was lumpy, but when she discovered some little bunny ears poking out of the hole, she got excited and got to work. She loves pulling out her "babies," and any other smaller toys we put in there for her. The bunnies have become a favorite toy on their own, too, and she carries them around, and loves to hand them to us and look expectantly while we admire her "baby." <3 She's still young, so has pulled at the carrot quite a bit, but hasn't destroyed it. I'm pleasantly surprised by the durability so far!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
R
Verified Purchase
Rand
Natrona Heights, US
★★★★★ 5
Great value for my pups
Perfect for my pups who love to unstuff things and make a mess. These are perfect and have not come apart! Fun colors and cute ! Great value for cost!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
L
Verified Purchase
Linda Ballerstein
Carnegie, US
★★★★★ 5
Plush Chew Toy
Our very strong chewer shitzu loves this toy and it has lasted thru her lovin' several days now.. with no rips or tears! She loves the different textures... A good buy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
R
Verified Purchase
Roger Springer
Cuba, US
★★★★★ 5
Her new best friend ♥️!
It was a big hit, our dog Betty loves it!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026

recommand products