Mouse CD95, his tag
SKU: 86101970480

Mouse CD95, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD95, his tagProduct Specification Species Mouse Synonyms Apo 1 antigen, Apoptosis mediating surface antigen FAS, FASLG receptor, Apt1, Tnfrsf6 Accession P25446 Amino Acid Sequence Protein sequence (P25446, Gln22 Arg169, with C 10*His) QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 18. 2 kDa

Product Specification


Species Mouse
Synonyms Apo-1 antigen, Apoptosis-mediating surface antigen FAS, FASLG receptor, Apt1, Tnfrsf6
Accession P25446
Amino Acid Sequence

Protein sequence (P25446, Gln22-Arg169, with C-10*His) QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 18.2 kDa Observed MW: 23-30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The Fas receptor, also known as Fas, FasR, apoptosis antigen 1 (APO-1 or APT), cluster of differentiation 95 (CD95) or tumor necrosis factor receptor superfamily member 6 (TNFRSF6), is a protein that in humans is encoded by the FAS gene. Fas was first identified using a monoclonal antibody generated by immunizing mice with the FS-7 cell line. Thus, the name Fas is derived from FS-7-associated surface antigen. The Fas receptor is a death receptor on the surface of cells that leads to programmed cell death (apoptosis) if it binds its ligand, Fas ligand (FasL). It is one of two apoptosis pathways, the other being the mitochondrial pathway.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86101970480

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 2442 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Andy Bui
San Leandro, US
★★★★★ 4
Great Outdoor Pickleballs for Practice and Games
Size: 6 Pack, Color: Multi
These pickleballs have been great overall for outdoor play. The colors are bright and easy to see on the court, which is especially helpful during evening games or when playing on darker surfaces. They have a consistent bounce and feel durable compared to some cheaper pickleballs I’ve tried before. I also like that they fly pretty true and don’t wobble too much during rallies. They work well for both casual games and more competitive practice sessions. The balls feel solid off the paddle and provide a good balance of speed and control. The only reason I’m giving 4 stars instead of 5 is because a couple of the balls started showing small cracks after extended outdoor use on rough courts. They still lasted longer than many other brands, but I expected slightly better durability considering the price. They can also feel a bit harder than some softer outdoor balls, especially in colder weather. Overall though, these are reliable pickleballs and definitely a good choice for outdoor play. I’d buy them again for practice and recreational matches.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
R
Verified Purchase
Reader
Waukegan, US
★★★★★ 5
The best outdoor pickleballs.
Size: 12 Pack, Color: Optic Yellow
These pickleballs are much cheaper than found in stores. Great quality. Rates at the top when researching the best outdoor pickleballs. This a no brainer, a must buy if you play the game. Well packaged. Fast delivery. The best price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
C
Verified Purchase
CE
Louisville, US
★★★★★ 5
Good quality
Size: 3 Pack, Color: Optic Yellow
These are really good quality. The color is easy to see on the outdoor court, especially when the sun is bright. Definitely has good bounce to them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
T
Verified Purchase
Trevor & Tiffany G
Lowell, US
★★★★★ 5
Franklin X-40 vs. Dura Fast 40 (vs. Onix)
Size: 12 Pack, Color: Optic Yellow, Size: 12 Pack, Color: Optic Yellow
Review order: Review summary (quick read) Review update (4-13-2021) Full review (long read) Summary: This review might save you a lot of time researching balls, but here's the summary if you don't want to read the full review... For 4.0+ play consider the Dura Fast 40 when preparing for certain tournaments, but expect only about 2 games per ball, which is quite annoying in my opinion... for 95% of players, definitely go with the Franklin X-40 (except when preparing for a Dura only tournament of course). If you just want the ball to last and last year after year and don't care at all about egging or quality of play consider the much softer and much slower and much bouncier Onix ball. The Onix ball is so soft that I can't recommend it for typical play, but it is actually an excellent choice when introducing new players to the game and it is often the preferred ball in 65+ play if mobility becomes a common issue because extra bounce = extra time to get there, but in my area many older players seem to play the X-40 just fine. * * * * * * * * * * * * * * * * * * * * * * * * Update: 4-13-2021: Popularity: Almost everyone in my area is playing the Franklin X-40 in every park. I finally saw a Dura in play yesterday, but it's been a long time! Outdoor tournaments in my state are now about 60% X-40 and about 40% Dura (Washington), so even in tournament play the Dura seems to be going out pretty quick. Seasonal durability of X-40: for the first year I don't think my group cracked a single X-40 (despite having a faster paced game), but using that same batch of balls this Spring, they've all been dropping like flies so now my 1 year old batch of X-40's probably isn't much more durable than brand new Dura's (very annoying to deal with those cracks). I just bought new X-40's yesterday and I'll be discarding the few X-40's that are left from last year when the new stock arrives. It will be new X-40's for me once a year from now on assuming quality doesn't slide... fresh manufacturing is apparently very important, so hopefully Franklin will keep their runs moderate, and maybe that's what Dura did wrong.(?) * * * * * * * * * * * * * * * * * * * * * * * * Full review: This review will focus largely on the physical & quality comparisons between the Franklin Outdoor X-40 pickleball and the Dura Fast 40 pickleball, but I'll also give a summary of my impressions from the mouth of experts and supplement also by my own amateur impressions and measurements. Dura hole specs: 16 drilled holes @ 0.325" & 24 drilled holes @ .264" Franklin hole specs: 40 drilled holes @ 0.288" Both balls have 40 holes with an average hole size of 0.288", but the Dura ball has a far more randomized hole pattern. I personally didn't notice any difference in spin characteristics or any notable advantage to the randomized hole pattern of the Dura. Franklin weight: 26g Dura weight: 25g Both balls are rotationally molded in one continuous piece so the seam is just as strong as the rest of the ball on either ball... the appearance of a seam is on the outside of the ball only but the visual molding mark is not actually separated in any way in the middle of the ball and the inside of the ball will likewise appear 100% seamless on either ball, so no true seam exists (both balls are true "1-piece" balls). The Dura ball has much smoother molding marks w/ no plastic flashing like the Franklin... this is primarily cosmetic but quality in this regard definitely goes to the Dura. Subjective color preference: in the shade I think the Dura "Neon" color looks better (see pic), but in typical full sun the green tint looks dingy on the Dura ball in my opinion, and I feel the Franklin "Optic Yellow" is a crisper color that's probably a little more visible. These are the only 2 ball colors I have to compare. I would prefer more dye to be used for a green ball so it still looks green in full sun because in my experience with disc golf and ball golf neon green is the most visible color and neon pink is good too... with these 2 options I'd pick the yellow... the green tint on the Dura is so subtle in full sun it ends up looking more like a dingy yellow rather than a green. A more apples to apples comparison would be Dura's yellow option but I'm pretty confident Franklin would win that contest also based on the notably higher translucency in the plastic used by Dura. Color: Franklin wins. Franklin X-40 country of origin: China Dura Fast 40 country of origin: Vietnam - - EXPERT INSPIRED IMPRESSIONS - - From what I've gathered, expect much longer play per dollar out of the Franklin and expect very little life out of the Dura. Dura's are supposed to be a little harder/better/faster, but they often only last a few games based on everything I've read and heard. For older players consider the Onix over either of these balls... softer balls bounce higher and hit slower which allows more time to get to the ball for longer rallies... the Onix seems to be the favorite for play in older aged groups. Based on expert advise from the "pickleball kitchen" youtube channel... Best performance award (fastest, hardest): Dura Fast 40 Best Value (also w/ great performance): Franklin Outdoor X-40 - - - except high level players should opt for the Dura due to tournament requirements (note: this observation may be outdated... check tournaments in your state to verify what local tournaments are still using the Dura in your area and which tournaments have switched to the X-40) Longest lasting, but soft and bouncy: Onix Note: I have not seen a single outdoor tournament publish the Onix as their ball. My personal recommendation for most players based on a lot of reviews and some research and a close look would be to skip the Dura and go straight to the Franklin X-40 until you're playing tournaments... if/when you advance to the level of playing serious tournament play I don't think it would take long to transition muscle memory and power from the Franklin outdoor ball to the Dura ball and a lot of money and annoyance can be saved w/ the Franklin over the very brittle Dura... Franklin X-40 balls don't last very long either (according to some... possibly old stock), but compared to the Dura it's a notable improvement strongly worth considering even if you're a quality buff like myself. Manufacturing quality: Dura wins Material durability: Franklin easily wins and Onix lasts much longer still if you don't mind a notably slower game (more similar to indoor) and more egging. Quality of play: Mixed... many elite players prefer the extra speed of the Dura, but I prefer the consistency of virtually everyone using the same ball and even more notably, I'd rather sacrifice just a little speed to get the higher consistency / predictability / reliability of an uncracked ball and I find it distracting to look for cracks all the time. Value (w/o sacrificing much): Franklin Despite the long read, I'm hoping this helps the reader save some time in selecting a pickleball, especially for players new to the game.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 15, 2020
S
Verified Purchase
Sean Bozarth
Natrona Heights, US
★★★★★ 5
Comfortable and Effective Ear Plugs for Swimming
Color: Multicolored 1, Size: 1 pair (Pack of 3)
I picked up these ear plugs for swimming and was pleasantly surprised by how well they work. They’re soft and flexible, so they fit comfortably without feeling like they’re digging into your ears, even during longer swim sessions. They do a great job keeping water out whether you’re in a pool or just showering, and they stay in place well without constantly needing adjustment. I also like that they’re reusable and easy to rinse off and store after use. Overall, this is a solid set of swim ear plugs that are comfortable, practical, and easy to use. A good choice if you spend a lot of time in the water and want something reliable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2026

recommand products